SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Y3NNN1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Y3NNN1
Domain Number 1 Region: 18-136
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000157
Family Pseudo ankyrin repeat 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1Y3NNN1
Sequence length 252
Comment (tr|A0A1Y3NNN1|A0A1Y3NNN1_PIRSE) Uncharacterized protein {ECO:0000313|EMBL:OUM68022.1} KW=Complete proteome; Reference proteome OX=73868 OS=Piromyces sp. (strain E2). GN=PIROE2DRAFT_4447 OC=Neocallimastigales; Neocallimastigaceae; Piromyces.
Sequence
MLDIVESGGGGGGGVEDLIYFLEKNNFTLEEWVKKQEEEEEGSFDLLIYAIENSASLDII
NFIIKQGGYKTLNYSFYDYRATPPVNNNGHSHAFCYGVYKVPLFSAIAAHNFEVANLLLK
NKADINYIIDSFYVLRPGFVKDYYFGDVIDYLHLFNSLTVDNLKFILHKGFNMRIINSGG
MIPQFISYPDEHKTALLEMIFKYFIYDNRDSFYQEAYSKENDRLIQVFLNYDGSEPDILF
NRINRYSKVVKS
Download sequence
Identical sequences A0A1Y3NNN1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]