SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Y4EJL7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1Y4EJL7
Domain Number - Region: 3-28
Classification Level Classification E-value
Superfamily BRK domain-like 0.0889
Family BRK domain-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1Y4EJL7
Sequence length 59
Comment (tr|A0A1Y4EJL7|A0A1Y4EJL7_9FIRM) Uncharacterized protein {ECO:0000313|EMBL:OUQ05428.1} KW=Complete proteome OX=29348 OS=[Clostridium] spiroforme. GN=B5E91_05250 OC=Erysipelotrichaceae; Erysipelatoclostridium.
Sequence
MDDQLRYYLRYHPHWYLILSRYPQEYNRLIQEYKDEKNQHFIDKIEQVSMLINMVEMML
Download sequence
Identical sequences A0A1Y4EJL7 B1C3A2
WP_004610211.1.10975 WP_004610211.1.2163 WP_004610211.1.33909 WP_004610211.1.48938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]