SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Y4ISF4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Y4ISF4
Domain Number 1 Region: 5-208
Classification Level Classification E-value
Superfamily Methenyltetrahydrofolate cyclohydrolase-like 1.44e-57
Family Methenyltetrahydrofolate cyclohydrolase-like 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1Y4ISF4
Sequence length 209
Comment (tr|A0A1Y4ISF4|A0A1Y4ISF4_9FIRM) Sugar ABC transporter substrate-binding protein {ECO:0000313|EMBL:OUP19782.1} KW=Complete proteome; Reference proteome OX=1965583 OS=Lachnoclostridium sp. An196. GN=B5F29_07320 OC=Bacteria; Firmicutes; Clostridia; Clostridiales; Lachnospiraceae.
Sequence
MGFTKNTCEEFVDVLASKAPVPGGGGASALVGAIGMALGNMVGSLTVGKKKYADVEADII
ALKEKATALQADFLRLVDADAEAFEPLSKAYGMPKETEEQKAEKARVMAIVLKDACAVPM
EIMEKCCEAIDVIEEFAAKGSALAISDAGVGVVFCKAALLGASLNVYINTKSMADKEYAA
SLNEKADKMIADYSKKADEIFAAVNARLR
Download sequence
Identical sequences A0A1Y4ISF4
WP_087154006.1.7251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]