SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Y4P7E4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Y4P7E4
Domain Number 1 Region: 15-188
Classification Level Classification E-value
Superfamily Archaeal IMP cyclohydrolase PurO 5.62e-23
Family Archaeal IMP cyclohydrolase PurO 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1Y4P7E4
Sequence length 241
Comment (tr|A0A1Y4P7E4|A0A1Y4P7E4_CLOSC) Inosine monophosphate cyclohydrolase {ECO:0000313|EMBL:OUP88281.1} KW=Complete proteome OX=84030 OS=Clostridium saccharolyticum. GN=B5F06_01180 OC=Bacteria; Firmicutes; Clostridia; Clostridiales; Lachnospiraceae.
Sequence
MNKISLSEELKNNAYPGRGIVIGRSADGTKAVAAYFIMGRSENSRNRVFVEDGEGIRTQA
FDPSKLTDPSLIIYAPVRVLGNKTIVTNGDQTDTIYEGMDRQLTFEQSLRSREFEPDGPN
YTPRISGIMHIENGHYNFAMSILKSDNGCPDSCLRYTFAYENPLPGEGRFIHTYMHDGNP
LPSFEGEPKPVEIPDDMDAFADMLWESLNEDNKVSLFVRYIDIATGEKRSRIINKNGNAN
E
Download sequence
Identical sequences A0A1Y4P7E4 D4CEF2 R5MG23
WP_008397985.1.84603 WP_008397985.1.9575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]