SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Y5KKJ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1Y5KKJ4
Domain Number - Region: 26-60
Classification Level Classification E-value
Superfamily Rabenosyn-5 Rab-binding domain-like 0.0628
Family Rabenosyn-5 Rab-binding domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1Y5KKJ4
Sequence length 117
Comment (tr|A0A1Y5KKJ4|A0A1Y5KKJ4_PSEPU) Uncharacterized protein {ECO:0000313|EMBL:OUS81282.1} KW=Complete proteome OX=303 OS=Pseudomonas putida (Arthrobacter siderocapsulatus). GN=CBP06_28050 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MRTQPLILALAVLGLAGCANDPAPDEQMRISEQALDQAKAVGATEQVETLKLAEDKLARA
KANMLTQDYRDARMRAEQAELDARLAEAQVLNQKSEEQLQVLQSRVKRLRKQLEVQP
Download sequence
Identical sequences A0A160IUC5 A0A173HIX2 A0A1Y5KKJ4 A0A2I0CE11 A0A2K4LDB0 A5W100
351746.Pput_1654 gi|148546892|ref|YP_001266994.1| WP_003254227.1.100978 WP_003254227.1.1079 WP_003254227.1.11138 WP_003254227.1.25319 WP_003254227.1.33269 WP_003254227.1.33725 WP_003254227.1.34900 WP_003254227.1.35996 WP_003254227.1.44137 WP_003254227.1.45427 WP_003254227.1.47320 WP_003254227.1.5613 WP_003254227.1.60844 WP_003254227.1.62773 WP_003254227.1.74642 WP_003254227.1.75189 WP_003254227.1.78345 WP_003254227.1.89748 WP_003254227.1.96951 gi|386011248|ref|YP_005929525.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]