SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Y6LJE4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Y6LJE4
Domain Number 1 Region: 1-102
Classification Level Classification E-value
Superfamily Pre-PUA domain 7.85e-35
Family Nip7p homolog, N-terminal domain 0.0000559
Further Details:      
 
Domain Number 2 Region: 103-178
Classification Level Classification E-value
Superfamily PUA domain-like 5.41e-24
Family PUA domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1Y6LJE4
Sequence length 190
Comment (tr|A0A1Y6LJE4|A0A1Y6LJE4_ZYMTR) 60S ribosome subunit biogenesis protein NIP7 {ECO:0000256|PIRNR:PIRNR017190} KW=Complete proteome OX=1276529 OS=Zymoseptoria tritici ST99CH_1A5. GN=ZT1A5_G4061 OC=Zymoseptoria.
Sequence
MRPLTDTETKTLFEKLANYTGRSLNNLLTDTTTDPNSKTPDRYVFRVQKDRVYYIRESLA
NLATSVARDSLLSLGTCLGKFTKTGKFRLHITALDVIAPHARYKVWVKANGEMPFLYGGH
VVKAHVGRWSEDAPEHAGVIVMSMNDTPLGFGVTARSTAEARKLDPTGIVTFRQADVGEY
LRDEDTLFAG
Download sequence
Identical sequences A0A0F4GZZ5 A0A1X7RNE9 A0A1Y6LJE4 A0A2H1G596 A0A2H1G8P3 F9X5S7
jgi|Mycgr1|91981|estExt_Genewise.C_30886 XP_003854386.1.87952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]