SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Z4SAT8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Z4SAT8
Domain Number 1 Region: 1-111
Classification Level Classification E-value
Superfamily XisI-like 2.49e-45
Family XisI-like 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1Z4SAT8
Sequence length 111
Comment (tr|A0A1Z4SAT8|A0A1Z4SAT8_9NOSO) FdxN element excision controlling factor protein like {ECO:0000313|EMBL:BAZ51836.1} KW=Complete proteome; Reference proteome OX=2005458 OS=Nostoc sp. NIES-4103. GN=NIES4103_44950 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Nostoc.
Sequence
MDKLESYRNIIRKILGSYLNITYANANIRNRAAFDLESDQYLIISEGWDNKKHLHSCLIH
IEIIHNKVWIQCDNTENGIANELVEAGIPKEDIVLGFHEPNVRKYTGFAVA
Download sequence
Identical sequences A0A1Z4SAT8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]