SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Z4T1X9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Z4T1X9
Domain Number 1 Region: 18-119
Classification Level Classification E-value
Superfamily XisI-like 2.35e-27
Family XisI-like 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1Z4T1X9
Sequence length 140
Comment (tr|A0A1Z4T1X9|A0A1Z4T1X9_9CYAN) XisI protein {ECO:0000313|EMBL:BAZ60986.1} OX=2005463 OS=Calothrix sp. NIES-4105. GN=NIES4105_67040 OC=Bacteria; Cyanobacteria; Nostocales; Rivulariaceae; Calothrix.
Sequence
MGPQSYTSLNEPNEMVATQYQQAIIDSLLESIPTNVIPDTLQIVPVFDLQSNRYQLLCQG
WTSGEKRVFHPVIHIEIINGKVWIQHNQTDVDIGEELSNRGIPKSQMVLGLHPPSIRELN
PIYDPGADELDNGAIKSAIY
Download sequence
Identical sequences A0A1Z4T1X9 A0A2H2Y9Y5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]