SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Z5KGM8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Z5KGM8
Domain Number 1 Region: 662-726
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000446
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0024
Further Details:      
 
Domain Number 2 Region: 732-839
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000085
Family Pseudo ankyrin repeat 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1Z5KGM8
Sequence length 971
Comment (tr|A0A1Z5KGM8|A0A1Z5KGM8_FISSO) Uncharacterized protein {ECO:0000313|EMBL:GAX25275.1} KW=Complete proteome; Reference proteome OX=1519565 OS=Fistulifera solaris (Oleaginous diatom). GN=FisN_5Lh359 OC=Bacillariophycidae; Naviculales; Naviculaceae; Fistulifera.
Sequence
MSSREEEDQAEEHRDGQRDGNNLLVAVGFPIDSELDSSASSQGGSTFLSGRETNNMDSSN
TRNQGTPFVHHSFGHEEIYAVTTLVEEEKTEIVALASTQIGTFDQSAASAAVIDTGEEDL
DEDELLTRELKRAAYGGYYVRDTTDDYEFHPTSFPPQATIVAIGDHQDADLTLGAVHATF
VGQDYAQLSTDTLINAGLDRESSRNESDRHTIPDNDTAEAMVIDSAPFDCQDNIPDWKVN
GEARVMSGESSLSAYAGNKLSTNESEGFSSIISGRLMEKPSAVSGIESRTNNQHGTASQE
AEVLGFREIHPSEFPHETTHAELISQGSMVAAADALVIDSNDRHPNRAYVGDSTILYEGD
THDGQQAEVLGIQEDVHPNEFPNETHAHFVGQVTAAHSESFERFSSEVVDPVYLYGAARE
HTMNEAELNQTATLITDARFETPLRETAASAPMEAAESTFVSNHVSPNNATVLPFASMPI
EDYRDEAVVLCVSTGEERASAWPEKVPVNHFNYNLDDVVQVEVCQTPTRSMNHNNNRSDV
PEFGCGGPSSSQRAAMQQITHSLARGTANVIGNIFGDTKPSFGGRRRSGETDNADAVVPR
TLLPWSVIPNSATNTWTATIQTNQNALERSDRMSIAEANKSLRAFVLPTEKAAVAFARAW
TPPRMKEKGPHCHICNSKFALLRRPCHCRNCGVVVCKECSVNWPSKMIPDTYNIKKESSV
NVCGSCDWLSSNFRLALLKGNQDRAVALHATGNINLHAPFGNVKGELLYPVHSAVLGGSL
PLLKWLVDDNSCPIKSLRVSGSREYGGSYIPVVTSKGRSLLGIALENRNVDIVRYLVVEK
GVALASEKDVTFEMLLRNLDRVLHLLPEDVGSSQPDESVLLDLSDNTSPDPVSRHEFNEI
QYRTMSEEARDLGAIPQPSEMHDDCIICCDSKIDCVATPCGHQVCCLKCSQQITRCPVCS
SDCTFMRVFKP
Download sequence
Identical sequences A0A1Z5KGM8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]