SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Z5KRQ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Z5KRQ8
Domain Number 1 Region: 45-84
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000942
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1Z5KRQ8
Sequence length 100
Comment (tr|A0A1Z5KRQ8|A0A1Z5KRQ8_FISSO) Protein dpy-30 {ECO:0000313|EMBL:GAX29004.1} KW=Complete proteome; Reference proteome OX=1519565 OS=Fistulifera solaris (Oleaginous diatom). GN=FisN_7Hu405 OC=Bacillariophycidae; Naviculales; Naviculaceae; Fistulifera.
Sequence
MDASNPQQMMMQQQQQHFQQMMLQQQQQQQQHQAQQGNDMQRLPIRAYLDQTVVPLLLDG
MSELVKERPANPIEYLANYLLKHDPQRIAAAAQAAQSSQK
Download sequence
Identical sequences A0A1Z5KRQ8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]