SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Z5SNU2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Z5SNU2
Domain Number 1 Region: 506-836
Classification Level Classification E-value
Superfamily Cytochrome P450 9.95e-45
Family Cytochrome P450 0.00058
Further Details:      
 
Domain Number 2 Region: 312-397
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000209
Family Pseudo ankyrin repeat 0.017
Further Details:      
 
Domain Number 3 Region: 238-338
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000523
Family Pseudo ankyrin repeat 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1Z5SNU2
Sequence length 882
Comment (tr|A0A1Z5SNU2|A0A1Z5SNU2_HORWE) Uncharacterized protein {ECO:0000313|EMBL:OTA22483.1} KW=Complete proteome; Reference proteome OX=1157616 OS=Hortaea werneckii EXF-2000. GN=BTJ68_14719 OC=Hortaea.
Sequence
MSSLMWENPMTKKQLTKIRRKWNWIQVLQPILWSFEEGKKKIASWETTDELVDAVRNQVD
LMNIGQDMDVSPTVRTVGYTAESGKDGSRQSTSRLPPELWTIIFDFTGDWELAQTLHIYT
NLTPPADWTSHTSPQGPRGYMEALELTILRGDLKDVEAFIASHSVPRWLSKLCIKLIMRF
AMTPLLAHLEANHKDLFWATFGHTFLPDKASSVFGRTEILEFWRTSPSFLTKEYNTEALD
GASRAGFVNVLEWWQHSALPLKFTEAALEQASAQGHLPVLEWWKQQSTTVDDMSVSVDSS
KVRLKPGKSICYATQNGHTEIVRWWCQSGIPFPHEDTVAKLASTHGHTDILQLWHELKGS
KMIFDNQVLVGATKNGNVRVLEWWKRSGLKVEYKTCDVEEALEDGDEGERGMEVRRWWAR
NGLNLGSKRYNQEAFSILLAGTRTNFIYSVEGITATFKSRQLSRSGLDQQLGINALGMSK
EDAKKAFPADLDAKGKLSTAKIHTEHLLSASAVNSLTVKFLECFVQELQNDPKLKDGAEV
NLYEWLWQRIFHASTTSLYGSKLLEMFPDFDKDYKVWEDNMLGLLFGVPRFMIGHAYKAR
DSNIKKLTAFLEEGYRNESEGDADWDPWFGARVVRKRHEYYHQQDLSTQGQAGCDLVFLA
GILSNATPATGWLLAHLLSPTSPPDLLPRVMEELKSAQRPDGSVDVLALTKLPLLNSAFH
ETLRLYVDLLIVRQVDSSVTLAGQHHVRQGEHVMAPSWMTHRDPNTFAQPDAFDPERFLS
QDPETGKLSYNTSRSAGSYFPFGGGHYMCPGRIFAKQEVLGSVATLLLNLDVTFVEFVHE
KGGRYSSAGRGGENFPALKDNYAGNQVVGMQGDLKVRLKAKA
Download sequence
Identical sequences A0A1Z5SNU2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]