SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A202DNJ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A202DNJ0
Domain Number 1 Region: 37-73
Classification Level Classification E-value
Superfamily Microbial and mitochondrial ADK, insert "zinc finger" domain 0.0000000000432
Family Microbial and mitochondrial ADK, insert "zinc finger" domain 0.002
Further Details:      
 
Domain Number 2 Region: 7-42,70-124
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000961
Family Nucleotide and nucleoside kinases 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A202DNJ0
Sequence length 131
Comment (tr|A0A202DNJ0|A0A202DNJ0_9BACT) Adenylate kinase {ECO:0000256|RuleBase:RU003331} KW=Complete proteome; Reference proteome OX=1932698 OS=bacterium F11. GN=BVX98_02250 OC=Bacteria.
Sequence
DQARALDSFSDKEKVVLDVILFFEVDSQELVKRLSARRQCGACKEVYNLVKRPPKTEGKC
DLCSGDLTQRPDDEASVVQERLRVYQVQTSPILDYYKGRGQLYMINAAQDIDRVFAEITA
IIQTRESHSPS
Download sequence
Identical sequences A0A202DNJ0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]