SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A210PLV5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A210PLV5
Domain Number 1 Region: 269-392,423-470
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.88e-26
Family Nucleotide and nucleoside kinases 0.00024
Further Details:      
 
Domain Number 2 Region: 60-178,209-254
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.81e-18
Family Nucleotide and nucleoside kinases 0.00048
Further Details:      
 
Domain Number 3 Region: 392-419
Classification Level Classification E-value
Superfamily Microbial and mitochondrial ADK, insert "zinc finger" domain 0.00000222
Family Microbial and mitochondrial ADK, insert "zinc finger" domain 0.0025
Further Details:      
 
Domain Number 4 Region: 13-51
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000366
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0049
Further Details:      
 
Domain Number 5 Region: 177-205
Classification Level Classification E-value
Superfamily Microbial and mitochondrial ADK, insert "zinc finger" domain 0.0000115
Family Microbial and mitochondrial ADK, insert "zinc finger" domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A210PLV5
Sequence length 478
Comment (tr|A0A210PLV5|A0A210PLV5_MIZYE) Adenylate kinase 8 {ECO:0000313|EMBL:OWF37406.1} OX=6573 OS=Mizuhopecten yessoensis (Japanese scallop) (Patinopecten yessoensis). GN=KP79_PYT04753 OC=Pectinoida; Pectinoidea; Pectinidae; Mizuhopecten.
Sequence
MDQTKRPLLIPPEFSTYAEKHGIFEMYKKLMEQLIVGKPADPVAFLIDLLKRDTHDVPQV
IIIGPPASGKKTISKMCATKLRTAHLTTENLIMEAETDLKMQMLDLQKKKQPIPIDVWVK
VIEERIKLPDCVRKGWVMEGFPQTREQALAIQSIGIHPKHCVLLDAPDTVLIERAHGKRV
DPKTGDIYHTTFDWPSSTEVQSRLEEAEGYGEDDMVEKLIEYHRHIDGILTCFTKGLKSV
NADQPQADVFLQVFTYLCGQARTNAPHTPRVVLLGATGSGKGVQASLLATKYNLVNVSCG
SLIKQAIADETKEGQTAIPYVSKDMLVPDVTVMQILRQRLSQMDCMSRGWVLHGYPRTRE
QAEGLTKGGFVPNRVFFLNVPNDSVVERLTLRATDPITGDRYHMLYNPPRTEDVKARLQK
LPKDESEQVNKRLGTYNAYVEEISDFYVDAQHVNADQDPHTVFECIESMIVNPLPRKV
Download sequence
Identical sequences A0A210PLV5
XP_021380330.1.56386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]