SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A210PVC9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A210PVC9
Domain Number 1 Region: 8-49
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000000000157
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0026
Further Details:      
 
Domain Number 2 Region: 86-223
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000814
Family Motor proteins 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A210PVC9
Sequence length 1382
Comment (tr|A0A210PVC9|A0A210PVC9_MIZYE) Sperm surface protein Sp17 {ECO:0000313|EMBL:OWF40450.1} OX=6573 OS=Mizuhopecten yessoensis (Japanese scallop) (Patinopecten yessoensis). GN=KP79_PYT22352 OC=Pectinoida; Pectinoidea; Pectinidae; Mizuhopecten.
Sequence
MAVPFSNTKLRVPKGFQNILEGLAREVLRNQPENIYEFGAKYFDQLLRVRDETGHDPAVH
GARMEDRFYNNDAFRSPGVDSGDPQQQDAALKIQTEYRRHSAKKEVDDMREEDAATTIQA
GVRGHQDRQKVDEIKEGEARLKSAEVDINLEDPEVEAAAVKIQAGFKGYKARKEVKESKE
AQEESPEEKKEEVDIDLEDPEVAKAATKIQAGFRGHKTRKELKSSEDAPKSETENAEPEK
IDIDLNDPEVAKAATKIQAGFKGYKTRKEMNGKQPLSDKDSRTSGLDKCDTDDIDFNDPD
VAKAATKIQANFKGHQVRKEIRKNQSAPETDRGHTDIHCSDDKHVMDDDNNEIDIDLSDP
EVEKAATKIQAGYKGLKTRRELKSIQEPKSTSIPVRDSMENVPTEEEIIDIDLTDPEVEK
AAVKIQSSFKGLRARKSKTASAASTSVESEPSNTTPPCPLSVKTEQQEEIDIDLNDPEVE
KAAVKIQATFKGLKSRRFGAKKSSPTNNLNNMKPVTPPVDKVPVEEEIDIDLNDPEVAKA
ALKIQSTFKGLKSRKFGKNKTSQSSPPINNVNPTPSPPVTAPVEDEIDIDLNDPEVAKAA
VKIQSTFKGLKSRKIKTKQSTQSPPSNIEPSPPPPVPVPTEEEVDIDLNDPEVEKAALKI
QSTFKGLKSRKFGAKKSSPTNIENVSPPVPPPPVTPPVKEEIDIDLNDPEVEKAAVKIQA
TFKGLKSRKFGSKKSSPSLVNKIPTPPPTVNIPSEEEIDIDLNDPEVEKAAVKIQATFKG
LKSRKFGKSKPVAPLKQPPSSNHVDAKSSEVEEIDIDLTDPDVEKAAVKIQASFKGLRAR
KTKNQQEAAPKEAEKKTEAQEEEIDIDLNDPETAQAALKIQAGFRGYKTRKEVKENLESE
GDKTEGEKPSEETKTTEEAKPEEEAKTEKTKEEPVDIDLNDPEVAKAATKIQAGFKGYKV
RKDMKGDKEGDAKETTVEAPAPTEDESAPKQEEAPAPTEEAPAPTEQAPAPTEEAPAPTE
QAPAPTEEAPAPTEQAPAPTEEAPAPTEQAPAPTEEAPAPTEQAPKEAKKQENIMELPLE
DGQRILEALSAFKTFKKPDTLPERLKLSRPQVKKLLKWYKTSKENIDEGTFTGMRRAAFQ
TQKTFSKINFFGKETDETEATDDDDDDDDNDFDDVNFLNGFFGKEGEAGFDESTLENLFA
NMFGGFGEAFKDDGNVSKSGISSGIGGMMTNMTESASNMVQPMMKLVDKSMYYKPVNAAI
ETLEPWIEQSRNILDDEQIKKLDKQLELYVEIKELFDQEQDDDESHEKEARGSRVLELSN
EIEKIGPLPKVVQDAMNKEAGTMDPENLPKMMENVGSVFTEGLSNMVSGGPKATETDNCT
IL
Download sequence
Identical sequences A0A210PVC9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]