SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A210PWP1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A210PWP1
Domain Number 1 Region: 327-363
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000012
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A210PWP1
Sequence length 399
Comment (tr|A0A210PWP1|A0A210PWP1_MIZYE) Uncharacterized protein {ECO:0000313|EMBL:OWF40893.1} OX=6573 OS=Mizuhopecten yessoensis (Japanese scallop) (Patinopecten yessoensis). GN=KP79_PYT19616 OC=Pectinoida; Pectinoidea; Pectinidae; Mizuhopecten.
Sequence
MSATTITSLTTSEAPSQVPTAVQETVPEEVPEPSDAAVKFLEGIVPEEDFKYLMFDDSLL
TTSTDTYTSGSKQGRELGEFTVSVEPTRHKQQDCYLIHANSHGSIDGVPCGTSITAYVGQ
NLETIEQQHHEYVKLENCPLDRKTFIVQQEDCYVVNRVITQGEDIQRSSRSIELSKMKGF
ISEGSNLLLHRLLIEKNFHSDDFQLLSFDSDTNICAAIYRPLEDRTQTVDGTEIRVYGVE
RTINSVVDLPTTWQSYFMQDGHLTNRVQVGSPVTMKLARVPNLIMRDEEPPKPTFEKRSL
QWDEDMQLYSKFLDRKEELKADHGSYVRHHPELKNLLADFLQFLLLRKPEDVVQFAAEYF
SAFSPAMPTATPYLASNAPTPFPASRTNTKIDQLRAPTR
Download sequence
Identical sequences A0A210PWP1
XP_021373298.1.56386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]