SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A210Q6H8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A210Q6H8
Domain Number 1 Region: 813-1013
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.63e-59
Family Ankyrin repeat 0.00015
Further Details:      
 
Domain Number 2 Region: 598-844
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.41e-56
Family Ankyrin repeat 0.00031
Further Details:      
 
Domain Number 3 Region: 11-84
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000913
Family DEATH domain, DD 0.01
Further Details:      
 
Domain Number 4 Region: 449-472,527-624
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000497
Family Pseudo ankyrin repeat 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A210Q6H8
Sequence length 1032
Comment (tr|A0A210Q6H8|A0A210Q6H8_MIZYE) Ankyrin repeat protein {ECO:0000313|EMBL:OWF44299.1} OX=6573 OS=Mizuhopecten yessoensis (Japanese scallop) (Patinopecten yessoensis). GN=KP79_PYT15833 OC=Pectinoida; Pectinoidea; Pectinidae; Mizuhopecten.
Sequence
MDVKYLGQLSLDIGKEWCLLAYELGFSDSQLDHLRAAFPYNTPQCVASMLVKWHETALKH
HINPLPLLIRSFTGVDRYDLVQKLNCEFDEPDDGSLFNNQNEKLSVFNAEVKKIRFGQAQ
GDMQMFLDQSERFLEFQVKDKKLFVNTRAARVALELLSTKGTLTLMGNPGDGKSTIAVNL
LTRLRNEGATIIVLSDPALIERIYDDDKQIVYFVDDAFGTPTVNSRLLETWTRLHDKIES
LVKLDKCKLLITTRKHVYMKCQSLLHKCPSYKENLIDLSGEEYRLNMIEKNRIVASYCQD
HGLFPAQLSFTKGSAYVPGFPLLCKMFGNDKRMQELDVYFDQTLSVLYNQLQMLATTDGH
SFCGLVLVMMFDGRLPRAVFDQFTPCCDQDRTKIQTIMRVYGIQACDDGKVETCLDEMIG
VYVEEVEEDFRFIHDAIFDTVCLIFGTRYPNEIIRVASSNFIEKRIRTENIPGANNHFLD
DVIVLKKSKYHVLAARWIADASRGIIRAMFVNPSIRDVDMQSALVDRIRKLAPKASMELL
TNAEEANTSSKNQFKETVLFLACKKGFVSLVQVLLEKQKLLKADNVVNASVLTIPDSCIM
EAVDRIHLNVVNALLDHGARVNFACGSMSYRCLQVACKKGSLDMVKLLMRYGADVNLEDH
NGKQAVHYASEFGRLEILKELHNNNASLSAKDRTDRQAIHYAGIAGSLECVQFLQQEGTH
LNVPDRMDKNVLHYASTAHCPALIRYLVSNGADINSIDSMGASPLHLACKANFAENIEIL
LSNGSDPNQVDASMRLPLHSACKFGGPEQDGRDSFRCVQLLLNVVSDVNAVDSFGKTALH
YACTWARDRRFDCVTLLLSKGADPSIMDDYERQPIFYACESGNLKCVQTLVNHGIDVNHR
GPQGKQPIHYACGRGNIDVVKMLVEKGASTNSVDSKGKQPLHYASQHGNNDCLSYLLECG
VDVNCVDKQGCRPLHYACKWCRPNAVRLLIKHGASPEEKDNDDRMPDDLVPKWSSRKSQM
KRFLRGHSLDTI
Download sequence
Identical sequences A0A210Q6H8
XP_021365971.1.56386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]