SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A210QGM4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A210QGM4
Domain Number 1 Region: 53-178
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000275
Family Pseudo ankyrin repeat 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A210QGM4
Sequence length 186
Comment (tr|A0A210QGM4|A0A210QGM4_MIZYE) Uncharacterized protein {ECO:0000313|EMBL:OWF47910.1} OX=6573 OS=Mizuhopecten yessoensis (Japanese scallop) (Patinopecten yessoensis). GN=KP79_PYT22575 OC=Pectinoida; Pectinoidea; Pectinidae; Mizuhopecten.
Sequence
MATDFSRLPEILKLHTDMVQKLGELFPVKGTKWHTILKKVQLLNLLSVADVEKIETMYDL
FLSLVQKKDNGITYGEYTSTRTILGSCNIDAEEIIDHYTGRIHAFYKDNLKTVLALQAET
SQRDNQSSISAKTTSDDESMAQLVTEKVSPDNELISAAACGHTETVTLLLEKGADPDEVL
KACKYG
Download sequence
Identical sequences A0A210QGM4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]