SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A210QK11 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A210QK11
Domain Number 1 Region: 4-92
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 3.27e-19
Family Inhibitor of apoptosis (IAP) repeat 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A210QK11
Sequence length 132
Comment (tr|A0A210QK11|A0A210QK11_MIZYE) Baculoviral IAP repeat-containing protein 1 {ECO:0000313|EMBL:OWF49085.1} OX=6573 OS=Mizuhopecten yessoensis (Japanese scallop) (Patinopecten yessoensis). GN=KP79_PYT25789 OC=Pectinoida; Pectinoidea; Pectinidae; Mizuhopecten.
Sequence
MFESPETRMTSFEEESNQLFEQGMISELSNAGFYYTGWQDVVACHACGIQLTEIAANKRV
MATHTRLSPSCPFIKETKGNAYIKDILDVVGQAVPQTIVTFNLRTFDNREEHHKDMFLFA
SSLPRSQSKDVF
Download sequence
Identical sequences A0A210QK11

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]