SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A210QKF2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A210QKF2
Domain Number 1 Region: 35-141
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 8.24e-35
Family Frizzled cysteine-rich domain 0.0000307
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A210QKF2
Sequence length 194
Comment (tr|A0A210QKF2|A0A210QKF2_MIZYE) Frizzled-1 {ECO:0000313|EMBL:OWF49225.1} OX=6573 OS=Mizuhopecten yessoensis (Japanese scallop) (Patinopecten yessoensis). GN=KP79_PYT24468 OC=Pectinoida; Pectinoidea; Pectinidae; Mizuhopecten.
Sequence
MHRKGITMRTTLLLYTVFVMLGVHLAVSQQSDEGPCQTITVPLCSTMPYSLAFMPNRFGH
SHMDDAGMVVHQFYPLVKVNCSAALKPFLCAAYFPKCSARGGGLEPCARLCREAKNGCAP
LMNRYGFQWPDTLDCHLFSENYRYRQTSVIYKFDRLVVQSGNEDTKIILRTIDFAVTITN
APVRFGKYQPVKSL
Download sequence
Identical sequences A0A210QKF2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]