SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A210QMB2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A210QMB2
Domain Number 1 Region: 1018-1204
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.57e-38
Family Nucleotide and nucleoside kinases 0.00000129
Further Details:      
 
Domain Number 2 Region: 598-780
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.15e-36
Family Nucleotide and nucleoside kinases 0.00000148
Further Details:      
 
Domain Number 3 Region: 818-1000
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.85e-35
Family Nucleotide and nucleoside kinases 0.00000168
Further Details:      
 
Domain Number 4 Region: 120-302
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.11e-28
Family Nucleotide and nucleoside kinases 0.0000812
Further Details:      
 
Domain Number 5 Region: 380-569
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.21e-26
Family Nucleotide and nucleoside kinases 0.0000561
Further Details:      
 
Domain Number 6 Region: 4-48
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000706
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A210QMB2
Sequence length 1208
Comment (tr|A0A210QMB2|A0A210QMB2_MIZYE) Adenylate kinase isoenzyme 5 {ECO:0000313|EMBL:OWF49868.1} OX=6573 OS=Mizuhopecten yessoensis (Japanese scallop) (Patinopecten yessoensis). GN=KP79_PYT03819 OC=Pectinoida; Pectinoidea; Pectinidae; Mizuhopecten.
Sequence
MTTDDAKSYLSKREIPRLFESLMTGLMYHRPTDHIKYLIDCLHKVQDKGSNNITWSAFVD
IRRTKTPLPPITPPDGKKRRSRPSSRQKEPSKIEEDKKNLDDKKASPLPPITKSEDGVPD
VPVILIVGGPGSGKLTQVKLLQKTYPGWVHLSMGDLLRSEIADKGSAEDKWEMIGDLVNR
GEMAPEDITADLILKSLKSHPKAEGFILEGYPRTVTQMKEFDKIVGRLDMAFMLDCDEHC
CTQRLLQRGKQEGRVHDNINAVQRRLTAFKNNTLPAAKVLDDRGKLFVINADRDIKEIAF
ELGQCFQKSIFGDKKGKKLVPPRCTVPNPPEEGSVPVAATYERPAEAIARTKSQLEDSMA
LAKDAPEIVNKDEGRKPELPTCPIIVLAGGPGSGKGTQAKMIIERYPGTVHVSMGDILRT
EISQKGTADQKWGMISSLVQQGEMAPEEVTVDLLKDNLAKHKDASAIILEGYPRDKTQVE
EFNKYIGGLNFVLLIDSEEYYMQKRLVDRGKETERIDDNLSAISSRINFFRNKTLPVLKH
YDDNGKLVALYGDRDIQEVFFDVTQVLDKAFFGDKAQQQPAPPSEDAALDTSVLKDTKIV
FVVGGPGSGKGTQCERIVQQFGFTHLSTGDLLRAEVASGSARGKELTSIMESGQLVPLDV
VLQLLKEKMMAAAATSSGFLIDGYPREMEQGTRFENEVAPCTCVLYFEASDETMTQRLLG
RALTSGRVDDNEETIKKRLTTFHDITTPVIDYFTQHDKVKKVSAERHVDEVYGDVKTIFD
ELVPGSTVPKKGAPTTPPPEVPTQETTPVDTSILKDTKVVFVVGGPGSGKGTQCERIVQQ
FGFTHLSTGDLLRAEVASGSARGKELTSIMESGQLVPLDVVLQLLKEKMVAAAATSSGFL
IDGYPREMEQGTRFENEVTPCTCVLYFEASDETMTQRLLGRALTSGRVDDNEETIKKRLT
TFHDITTPVIDHFSQQEKLKKVSAERDVADVFTDVQEIFNNITGAKAKKESTDAAPSLKD
AKVIFVVGGPGSGKGTQCAKIVEKYGFCHLSSGDLLREEVSSGSDRGKRLNEIMEKGELV
TLDEVLALLRNAMEAKISTSKCFLIDGYPRELEQGTRFENEIVECTSVVYFEVPDEVMTE
RLLERGKTSGRVDDNEETIKKRLETFHNQTKPVVDHYASKDKAVKIVATGTVDEIFAEVQ
KFMDSKTW
Download sequence
Identical sequences A0A210QMB2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]