SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A212CCE2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A212CCE2
Domain Number 1 Region: 8-53
Classification Level Classification E-value
Superfamily Retroviral matrix proteins 0.00000000135
Family MMLV matrix protein-like 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A212CCE2
Sequence length 142
Comment (tr|A0A212CCE2|A0A212CCE2_CEREH) Uncharacterized protein {ECO:0000313|EMBL:OWK03663.1} OX=46360 OS=Cervus elaphus hippelaphus (European red deer). GN=Celaphus_00013891 OC=Pecora; Cervidae; Cervinae; Cervus.
Sequence
MIKNLKMEFGGDYGAKVTPNCFHLHCEVKWPPMGVGWPPENTMNLKIVKAVYTDLDGDDL
TPPPYGVMRHLPPSAPLGPEAALMPDPGPGEVPAAATALPPALLEIVEPPFLQAPIPAME
TSDQCPQDSTSAGPPRLYPPLL
Download sequence
Identical sequences A0A212CCE2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]