SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A212CJL7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A212CJL7
Domain Number 1 Region: 6-46
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000000000602
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A212CJL7
Sequence length 191
Comment (tr|A0A212CJL7|A0A212CJL7_CEREH) ROPN1 {ECO:0000313|EMBL:OWK06209.1} OX=46360 OS=Cervus elaphus hippelaphus (European red deer). GN=Celaphus_00012685 OC=Pecora; Cervidae; Cervinae; Cervus.
Sequence
MPQTDKQICIPPELPDLLKQFTKAAIRSQPQDLIQWAADYFGAMSRGEIPPVRERSERVA
LSNWAELTPELLKILHSRVGGRLIVHADELAQMWKVLNLPTDLFNSVMNVGRFTEEIEWL
KFLALACSSLGVTIAKTLKIVCEVLSSDHDSGPPRIPFSTFQFLYTYIAEVDGEISASHV
SRMLNYIEQEV
Download sequence
Identical sequences A0A212CJL7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]