SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A212CUY1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A212CUY1
Domain Number 1 Region: 201-317
Classification Level Classification E-value
Superfamily eIF-2-alpha, C-terminal domain 2.49e-42
Family eIF-2-alpha, C-terminal domain 0.000000665
Further Details:      
 
Domain Number 2 Region: 104-197
Classification Level Classification E-value
Superfamily eIF2alpha middle domain-like 1.44e-33
Family eIF2alpha middle domain-like 0.00000188
Further Details:      
 
Domain Number 3 Region: 26-107
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000000025
Family Cold shock DNA-binding domain-like 0.0000265
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A212CUY1
Sequence length 329
Comment (tr|A0A212CUY1|A0A212CUY1_CEREH) Uncharacterized protein {ECO:0000313|EMBL:OWK09791.1} OX=46360 OS=Cervus elaphus hippelaphus (European red deer). GN=Celaphus_00006066 OC=Pecora; Cervidae; Cervinae; Cervus.
Sequence
MGRPRQYADSGGDLRMPGLSCRFYQHKFPEVEDVVMVNVRSIAEMGACVSLLEYNIKGMI
LLSELSRRRIRSINKLIRIGRNECVVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFTKSK
TVYSILRHVAEVLEYTKDEQLESLFQRTAWVFDDKYKRPGYGAYDAFKHAVSDPSILDSL
DLNEDEREVLINNINRRLTPQAVKIRADIEVACYGYEGIDAVKEALRAGLKCSTETMPIK
INLIAPPRYVMTTTTLERTEGLSVLNQAMAVIKEKIEEKRGVFNVQMEPKVVTDTDETEL
ARQLERLERENAEVDGDDDAEEMEAKAED
Download sequence
Identical sequences A0A212CUY1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]