SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A212DB29 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A212DB29
Domain Number 1 Region: 118-234
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.88e-33
Family cAMP-binding domain 0.000000589
Further Details:      
 
Domain Number 2 Region: 13-61
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 3.92e-19
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000733
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A212DB29
Sequence length 235
Comment (tr|A0A212DB29|A0A212DB29_CEREH) PRKAR1A {ECO:0000313|EMBL:OWK15344.1} OX=46360 OS=Cervus elaphus hippelaphus (European red deer). GN=Celaphus_00001696 OC=Pecora; Cervidae; Cervinae; Cervus.
Sequence
MASGTTASEEERSLRECELYVQKHNIQALLKDSIVQLCTARPERPMAFLREYFEKLEKEE
AKQIQNLQKAGSRADSREDEISPPPPNPVVKGRRRRGAISAEVYTEEDAASYVRKVIPKD
YKTMAALAKAIEKNVLFSHLDDNERSDIFDAMFPVSFIAGETVIQQGDEGDNFYVIDQGE
MDVYVNNEWATSVGEGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILM
Download sequence
Identical sequences A0A212DB29

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]