SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A212EIE9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A212EIE9
Domain Number 1 Region: 106-230
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.96e-33
Family cAMP-binding domain 0.00000893
Further Details:      
 
Domain Number 2 Region: 240-372
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.67e-33
Family cAMP-binding domain 0.0000522
Further Details:      
 
Domain Number 3 Region: 8-49
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000000115
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A212EIE9
Sequence length 382
Comment (tr|A0A212EIE9|A0A212EIE9_DANPL) cAMP-dependent protein kinase R2 {ECO:0000313|EMBL:OWR41254.1} KW=Complete proteome; Reference proteome OX=278856 OS=Danaus plexippus plexippus. GN=KGM_211789 OC=Danaus.
Sequence
MSRPQGGRIQVPDDLREILLEFTISYLLEQPGDVINYAVEFFTRLQNNRTTTIVRGPSAG
TPDESIISDEEEPPVARFNNRRKSVFAETYDPEEDDSDEGAPAVFPKSDAQRARLADAVR
GILLFRSLDAQQMQQVLDAMFEKRSEPGEYVIRQGDDGDNFYVIENGVFDVLVTGDDGVE
KVVHTYEGSGSFGELALMYNMPRAASVRATSPGALWAMDRHTFRRILLKSAFKKRKLYEE
LLDKVPMLKALQSYERANLADALLPRTLIDGELIIRQGDTADGMYFVEDGSVSIRIARDD
GNEHEIKRLGKGGYFGELALVTHKPRAASAYAVGPTKVAFLDVETFERLLGPCMEIMKRN
IDDYEEQLVKLFGDKSNLTDVR
Download sequence
Identical sequences A0A212EIE9
DPGLEAN07066-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]