SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A212EYE5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A212EYE5
Domain Number 1 Region: 16-156
Classification Level Classification E-value
Superfamily Nucleoside diphosphate kinase, NDK 3.14e-40
Family Nucleoside diphosphate kinase, NDK 0.00035
Further Details:      
 
Weak hits

Sequence:  A0A212EYE5
Domain Number - Region: 173-202
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0811
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A212EYE5
Sequence length 235
Comment (tr|A0A212EYE5|A0A212EYE5_DANPL) Non-metastatic cells 5 protein expressed in {ECO:0000313|EMBL:OWR46516.1} KW=Complete proteome; Reference proteome OX=278856 OS=Danaus plexippus plexippus. GN=KGM_200496 OC=Danaus.
Sequence
MSVASSDSGAEYHTFSERTLAIIKPEAFDDADAIEDHIVDNGFMILARRKVKLTPEQAAE
LYRGHYGRHHFPHLVAHMSSGPIIALVLAAQNCIHKWRVLMGPARVVEAQAYWPDSLRAC
YGRRTKYGDYFNALHGSENYGEAIREIHFFFPEMIVGPLLRQWQVGDYILKYISPTLAPA
LTTLAHDRPAEPLLWLADYLRRHNPNQPELAPQPTDMREERKCQTPTPSEVTPDK
Download sequence
Identical sequences A0A212EYE5
DPGLEAN21768-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]