SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A218U6V0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A218U6V0
Domain Number 1 Region: 111-206
Classification Level Classification E-value
Superfamily Hsp90 co-chaperone CDC37 1.57e-41
Family Hsp90 co-chaperone CDC37 0.0000024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A218U6V0
Sequence length 216
Comment (tr|A0A218U6V0|A0A218U6V0_9PASE) Hsp90 co-chaperone Cdc37 {ECO:0000313|EMBL:OWK49398.1} KW=Complete proteome; Reference proteome OX=299123 OS=Lonchura striata domestica (Bengalese finch). GN=RLOC_00000658 OC=Estrildidae; Estrildinae; Lonchura.
Sequence
MEQFQKEKEELDKGCRECKRKLAECQRKLKELEVAEPESGKGELEKLQAEAQQLRNEEKS
WENKLEELRKKEKNMPWNVDTLSKDGFSKSVFNVKAKEKEETEEQKEKKHKTFVERYEKQ
IKHFGMLRRWDDSQKYLSDNPHLVCEETANYLVIWCIDLEVEEKHALMEQVAHQTIVMQF
ILELAKSLKVDPRACFRQFFTKIKVKIPPGLPKIPP
Download sequence
Identical sequences A0A218U6V0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]