SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A218U8L4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A218U8L4
Domain Number 1 Region: 43-80
Classification Level Classification E-value
Superfamily Defensin-like 0.0000748
Family Defensin 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A218U8L4
Sequence length 91
Comment (tr|A0A218U8L4|A0A218U8L4_9PASE) Gallinacin-11 {ECO:0000313|EMBL:OWK50015.1} KW=Complete proteome; Reference proteome OX=299123 OS=Lonchura striata domestica (Bengalese finch). GN=RLOC_00000732 OC=Estrildidae; Estrildinae; Lonchura.
Sequence
MCRAQTFHHEALLLPHGSPAFPPPGCSSTTGNPIPPVGPGLPRDTLRCLEYHGYCFHLKS
CPEPFAAFGTCYRRRRTCCLGTCGSRAQQGK
Download sequence
Identical sequences A0A218U8L4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]