SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A218VC93 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A218VC93
Domain Number 1 Region: 251-390
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.88e-36
Family cAMP-binding domain 0.0000017
Further Details:      
 
Domain Number 2 Region: 116-241
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.06e-32
Family cAMP-binding domain 0.0000013
Further Details:      
 
Domain Number 3 Region: 2-43
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000000000314
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A218VC93
Sequence length 399
Comment (tr|A0A218VC93|A0A218VC93_9PASE) cAMP-dependent protein kinase type II-alpha regulatory subunit {ECO:0000313|EMBL:OWK63559.1} KW=Complete proteome; Reference proteome OX=299123 OS=Lonchura striata domestica (Bengalese finch). GN=RLOC_00009662 OC=Estrildidae; Estrildinae; Lonchura.
Sequence
MSIEIPPGLTELLQGYTVEVLRHRPSDLLGFAAEYFARLRDARDQEAGGGRRVVSFDGEP
MQTESNGDEEPDRGDDESDSDFEPPVVNRYNRRVSVCAEAFNPDEEEEDTEQRVVHPKTD
EQRCRLQEACKDILLFKNLDQEQLSQVLDAMFERKVKPQEHVIDQGDDGDNFYVVERGVY
DIVVAKDNQSRCVGRYDNHGSFGELALMYNTPRAATIVATTEGALWGLDRVTFRRIILKN
NAKKRKTYELFIESVPLLKSLEPSERMKIVDVIGEKVYQDGERIISQGDKADCFYIVESG
EVKILIKSKTMTSKEANQEVEIARCHRGQYFGELALVTNKPRAASAYAVGEVKCLVMDVQ
AFERLLGPCMDIMKRNITHYEEQLVAMFGSSMDLMDPGN
Download sequence
Identical sequences A0A218VC93
XP_002188690.1.42559 XP_021386684.1.53032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]