SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A218ZNW3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A218ZNW3
Domain Number 1 Region: 9-67
Classification Level Classification E-value
Superfamily Preprotein translocase SecE subunit 0.0000000000000968
Family Preprotein translocase SecE subunit 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A218ZNW3
Sequence length 70
Comment (tr|A0A218ZNW3|A0A218ZNW3_9EURY) Protein translocase SEC61 complex subunit gamma {ECO:0000313|EMBL:OWP55023.1} KW=Complete proteome OX=1961135 OS=Cuniculiplasma sp. C_DKE. GN=B2I18_07465 OC=Cuniculiplasmataceae; Cuniculiplasma.
Sequence
MSVEEDLVEVQKKIERRFSGIGKGKYARIIKMAKKPGSQEYVKVLAITGAGIIFLGALGF
LIYYLMTIAF
Download sequence
Identical sequences A0A1N5SGX3 A0A218ZNW3 T0LYV1
WP_021789305.1.86882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]