SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A224XJN4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A224XJN4
Domain Number 1 Region: 14-46
Classification Level Classification E-value
Superfamily PMP inhibitors 0.0000000916
Family PMP inhibitors 0.001
Further Details:      
 
Domain Number 2 Region: 115-145
Classification Level Classification E-value
Superfamily PMP inhibitors 0.0000053
Family PMP inhibitors 0.0019
Further Details:      
 
Domain Number 3 Region: 59-89
Classification Level Classification E-value
Superfamily PMP inhibitors 0.0000228
Family PMP inhibitors 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A224XJN4
Sequence length 221
Comment (tr|A0A224XJN4|A0A224XJN4_9HEMI) Putative serine protease inhibitor i/ii {ECO:0000313|EMBL:JAW12705.1} OX=156445 OS=Panstrongylus lignarius. GN= OC=Panheteroptera; Cimicomorpha; Reduviidae; Triatominae; Panstrongylus.
Sequence
LAAPDRVAERVPKKTCEPGTTWKEECHSCACTSEGKIDCTKEACPPQLVPRSKRSLEKQD
CKEGETWKEDCHTCVCASGKPACTRELCESEASHKVVLPTSSDESNDHKTTKREAECAEG
EVWKDDCHTCHCTYGKKACTRELCLSESDLKVTVPEDNERTKRDYESAEDSSSSSEEEKC
PPNVKEWKEDCNHCYCDNGEKVCTKALCPDQGSVVAIKPKQ
Download sequence
Identical sequences A0A224XJN4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]