SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A224YJ58 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A224YJ58
Domain Number 1 Region: 116-235
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 8.9e-36
Family cAMP-binding domain 0.0000019
Further Details:      
 
Domain Number 2 Region: 245-370
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.31e-30
Family cAMP-binding domain 0.00000209
Further Details:      
 
Domain Number 3 Region: 10-57
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 1.7e-19
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A224YJ58
Sequence length 378
Comment (tr|A0A224YJ58|A0A224YJ58_9ACAR) cAMP-dependent protein kinase regulator {ECO:0000313|EMBL:MAA17677.1} OX=60191 OS=Rhipicephalus zambeziensis. GN= OC=Rhipicephalus; Rhipicephalus.
Sequence
MASTQEEEQSLRECELYVQKHNIQKLLKDCIVQLCVSRPDNPISFLREYFARLEKEAATR
AKQQQLSPMATTPPCEEKEDELSPLPVPPQRSRRGAVSAETYSEEDATSYVKKMVPKDYK
TMAALSKAIEKNVLFSHLDDNERSDIFDAMFPVVHKAGEVIIQQGDEGDNFYVIDQGEVD
VYVNGQHVTTIAENGSFGELALIYGTPRAATVKAKTDVKLWAIDRDTYRRILMGSTIRKR
KMYEEFLSKVSILESLDKWERLTVADALEPVTFNDGDIIVEQGMPGDDFFIIEEGSASVL
QRRSESEPQEEVGRLGPSDYFGEIALLLDRPRAATVVSRGPLKCVKLDRSRFERVLGPCA
EILKRNMTHYNSLISLSV
Download sequence
Identical sequences A0A131YY08 A0A224YJ58

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]