SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A225UKT4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A225UKT4
Domain Number 1 Region: 3-61
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000353
Family Pseudo ankyrin repeat 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A225UKT4
Sequence length 71
Comment (tr|A0A225UKT4|A0A225UKT4_9STRA) Uncharacterized protein {ECO:0000313|EMBL:OWY93837.1} KW=Complete proteome; Reference proteome OX=4795 OS=Phytophthora megakarya. GN=PHMEG_00036612 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MDDASTNGHLEVVQWLHIHEKAKCTIDAMKRAAMYEGFTIDALDDAACNGHLEVVRWLHD
NRNEGCSGRAI
Download sequence
Identical sequences A0A225UKT4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]