SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A225UNI1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A225UNI1
Domain Number 1 Region: 44-144
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000000000432
Family Pseudo ankyrin repeat 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A225UNI1
Sequence length 152
Comment (tr|A0A225UNI1|A0A225UNI1_9STRA) Uncharacterized protein {ECO:0000313|EMBL:OWY94520.1} KW=Complete proteome; Reference proteome OX=4795 OS=Phytophthora megakarya. GN=PHMEG_00035717 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MWSNGSTNTPIWTLSSWTSNTVFATRMLVRTVIDWKDPRDWLVGGSCGVSRTDAMDWAAF
GDEICSEQAVHYAAEAGNLQVLLWLNSTNRSVWTARAMDCAARGGQLEVVKWLHNNRNEG
CSVAAMDWASGNGHLEVVNWLRANRSINRVSS
Download sequence
Identical sequences A0A225UNI1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]