SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A225UPB7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A225UPB7
Domain Number 1 Region: 84-167
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000471
Family Pseudo ankyrin repeat 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A225UPB7
Sequence length 199
Comment (tr|A0A225UPB7|A0A225UPB7_9STRA) Uncharacterized protein {ECO:0000313|EMBL:OWY94833.1} KW=Complete proteome; Reference proteome OX=4795 OS=Phytophthora megakarya. GN=PHMEG_00035328 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MVVNLILHRNLATCVPDIITTIISDFLITDLTLAQACQWTHIGSTFLLDLVWMRSLRDVK
TSKWTLAKLLQSERHYHQWACSQSLIKVIQRGDLVLVQWLLTHFSRCTVSKEVVEKAAQC
GNLWVLQLLEGDKRHGGIEWSENSVNEAARIGNWELVKWLLKRTPSTRETRRANDDVVTV
PSYKIIWSRLNGQLKLALG
Download sequence
Identical sequences A0A225UPB7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]