SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A225V3F8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A225V3F8
Domain Number 1 Region: 91-137,207-255
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000706
Family Pseudo ankyrin repeat 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A225V3F8
Sequence length 260
Comment (tr|A0A225V3F8|A0A225V3F8_9STRA) Uncharacterized protein {ECO:0000313|EMBL:OWY99477.1} KW=Complete proteome; Reference proteome OX=4795 OS=Phytophthora megakarya. GN=PHMEG_00029514 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MSTCASTANALLIVTLLFRSRPEFEQLSHVVDATSVYLDSSVKLDVAKACKFNSVGLLER
IWRQHNVQQIETDQREFQRAISTAIPLQGTELLSWLLDHFRDCFIPSQIVQHAAAQGKWK
VLHLFKDKCASWTDTSEFVDGSMSPDVVNLFFQQELDHSRDGSLGMDDLLDFLCCENVER
GEIVQRLGLAMKEASKPCVKVEWNSNDIVCAAQNQQIATVKWLYNHSPAYHDIDNTIRAA
AGNQDVALVEWLRARYQYGA
Download sequence
Identical sequences A0A225V3F8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]