SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A225V5B1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A225V5B1
Domain Number 1 Region: 20-363
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.8e-21
Family Ankyrin repeat 0.0084
Further Details:      
 
Domain Number 2 Region: 441-522
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000000222
Family Pseudo ankyrin repeat 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A225V5B1
Sequence length 611
Comment (tr|A0A225V5B1|A0A225V5B1_9STRA) Uncharacterized protein {ECO:0000313|EMBL:OWZ01096.1} KW=Complete proteome; Reference proteome OX=4795 OS=Phytophthora megakarya. GN=PHMEG_00027589 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MLELEDGRGPWENDFDGTIEVAATRGYLDIVQWLYERGINYHKIKGVENEKLGFIARIWQ
AKNHPTYPLELAAEHGHLEVVQWLCKIHSTSCALYSNALNKAVANGHLTIAQLLNRFTAK
ACSAKSAADAAENGHLEMLQWLHSTNLLVCTTDIVDRAASKGHLHIVKWLYETHTQCGSS
RALRRAAGNGHLEVVEWIYDNVTKDIPMNDVWWKVANGGHLNVLKWIYIHFPGTFSMGTM
DGAAAGGHLEVVMWLHEYPNTGFTYAAPYWAAHHGHLRVLQTLYTYNSEVFTTSLVNNSL
KYNRYLSESIGNTAARNGHLEIVQWLHEHQCGGFTTVAMDNAAEYDHLNVVLYLMEHRTE
GFSSDAMQRPKHIEVHCSFNRSTANLMTRTQLKMLQSISETRPSFIQGCLRCLAEIAVRT
SNITILDWMKQFGLEFCSDVPIRNAVCRGHVKLLQWFHRNGFEMDGRELLELAVEYGHLD
TARWIWKHGYEITLDLVDIAGKRGCIRLFRWLLEYGPPLDLRIAKRLAMKWKNMEILWWV
SETDRVQVVLNAVKNDDRHVLSWVLMRTRFKDETSRQIIRDEIQRTSNKILLWIQENLAE
YEECSWCVTTS
Download sequence
Identical sequences A0A225V5B1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]