SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A225VKP9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A225VKP9
Domain Number 1 Region: 1-133
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000000000366
Family Pseudo ankyrin repeat 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A225VKP9
Sequence length 159
Comment (tr|A0A225VKP9|A0A225VKP9_9STRA) Uncharacterized protein {ECO:0000313|EMBL:OWZ05654.1} KW=Complete proteome; Reference proteome OX=4795 OS=Phytophthora megakarya. GN=PHMEG_00022222 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MDLAAANGHLQVVKWFGRLDILQWLDEQLVEGFAYTAMECAAAGGHFDILKWLYEKHLKP
CTRRALDVAVHGNLEVITRMPNAYSMSKVVAEAGHGNLEMVKWILAHGENLNIKSAMERA
IVYKEPEIVFFLDRHRIDHEESFTKMRARLRYKTPFSIS
Download sequence
Identical sequences A0A225VKP9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]