SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A225VL61 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A225VL61
Domain Number 1 Region: 89-174
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000602
Family Pseudo ankyrin repeat 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A225VL61
Sequence length 186
Comment (tr|A0A225VL61|A0A225VL61_9STRA) Uncharacterized protein {ECO:0000313|EMBL:OWZ05270.1} KW=Complete proteome; Reference proteome OX=4795 OS=Phytophthora megakarya. GN=PHMEG_00022670 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MESPLQLKIVEFALTMFTDNDRDSRLHPSDLLISNIPLSKAIELNHPGSVMLLDLVWMRS
LRDMGHSRWSVAKLLQSEKDYYTWEFSLALVRAIRCADLNMMQWILTHFSVCLVENAVME
KAARGGNLKVLQLLKNGNSHGGIEWGLKCVKAAGHWDIVHWLHQHVQLQLPDSKTNLQNT
HSIKAI
Download sequence
Identical sequences A0A225VL61

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]