SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A225VP43 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A225VP43
Domain Number 1 Region: 254-557
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.37e-18
Family Ankyrin repeat 0.0083
Further Details:      
 
Domain Number 2 Region: 64-92,184-273
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000915
Family Pseudo ankyrin repeat 0.022
Further Details:      
 
Domain Number 3 Region: 39-202
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000118
Family Ankyrin repeat 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A225VP43
Sequence length 622
Comment (tr|A0A225VP43|A0A225VP43_9STRA) Uncharacterized protein {ECO:0000313|EMBL:OWZ06874.1} KW=Complete proteome; Reference proteome OX=4795 OS=Phytophthora megakarya. GN=PHMEG_00020816 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MDLMNWIWENSRMDQKSRPNWSLCNFLQSDKQYYQWQFSKCLEYAAKRGDLVRVKWLFDH
FKECEVPHHVIYAAAETGQLAVLKFLLNHDYGVYGAKIDSPEVKKRKVESEIDVQSRITV
KWGSRNVEHALCNEHPEVAQWFYKHVPKGEYDHGDDRIRNLISGALDAGADEFAEALVPQ
GSNILDFAMDCNRLEVIERLVDGGYFVRDDFNAARSIEALVRADRLDLMKRISTQQNFPP
DHAVHWESHWFYAMSNACHTGNVSILRWLIEHPLGRILLKVEKRSKKLNGLILRAAEGGH
TDVMEYLHDEGIITEYKYALLLAIRKNQLGSVKWLVQHFPQSEIIPDYCIMDEAAKFGRI
EILEYLQSLDASIIPGWAPIHTSRNGETGQTALATIRVSPTDANLKVYKGAVQCQATWLP
TDPMDHASANGHFDLVKWFDSNRPEGCTTAAIDAAAANGHFEIVQWLRVNGKRGFTTKAM
DGAASNGNLEMVKWLHENGGAGCTKAAMDRAASNGYLQMLKWLYTNRSEGCTINALEGAL
GRGHLHVVCWLQMHYPQYSPSNMDIEVFTDNKFEIFLFVHIHYAYILTRTFVQDILGDDM
RGNPNGNDAYIFNWLQEKYVEE
Download sequence
Identical sequences A0A225VP43

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]