SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A225VSD1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A225VSD1
Domain Number 1 Region: 23-107
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000759
Family Pseudo ankyrin repeat 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A225VSD1
Sequence length 189
Comment (tr|A0A225VSD1|A0A225VSD1_9STRA) Uncharacterized protein {ECO:0000313|EMBL:OWZ08451.1} KW=Complete proteome; Reference proteome OX=4795 OS=Phytophthora megakarya. GN=PHMEG_00019005 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MYYKSTVKTGSVKTGNVKTVKWLDLKAEHLNQLTVMLHVVTSKYSGGFMSTAHAMDIAAA
AGHLNVVKWRHLNRSEGCSNQALTHAIISGHLDVVLFLYLHCEKEIVLNDYKRQFCPELQ
QWLLTPKLHRPSQQLAFPRNRLNMDTLHLISHHNCEQGVTRDARSSQKRWLLNRTAELAA
SRGDLPTLQ
Download sequence
Identical sequences A0A225VSD1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]