SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A225WSA1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A225WSA1
Domain Number 1 Region: 19-206
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.87e-48
Family PAPS reductase-like 0.0000281
Further Details:      
 
Domain Number 2 Region: 280-351
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000458
Family Thioltransferase 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A225WSA1
Sequence length 360
Comment (tr|A0A225WSA1|A0A225WSA1_9STRA) Phosphoadenosine phosphosulfate reductase {ECO:0000313|EMBL:OWZ19929.1} KW=Complete proteome; Reference proteome OX=4795 OS=Phytophthora megakarya. GN=PHMEG_0005734 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MTASVYDESQYESLEAYADALNAQLEGKTAQEIVKWTFETFGARTVLSSSFGIQSAVMLH
LTRSVSKNIPVVWVDTGYLPKETYQFAAHLTKLLDLDVRVYQSPITPARMEALYGKLHEL
ETPDAHRKYGFIRKVEPMQRALKELNTAALLVGVRADQTQHRQNMKIVNVYEGRLKVCPI
LNWSKTQIEQYMTANELEFHPLKAQGYESVGDAHSSRPVTQADKGNDHKGNDRAGRFNGK
EQECGLHLDMHDMKLEDFKFDDPLALSERDQEFLALTKRAKGITVFTKPTCKYCLAAKDV
MREREWAFDEVSVPTEVSIQSLQQIVGQPVKTVPQIFLDGKYIGGYTEFVTHLNIPSRFA
Download sequence
Identical sequences A0A225WSA1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]