SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A225X3G1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A225X3G1
Domain Number 1 Region: 62-388
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.15e-22
Family Ankyrin repeat 0.0016
Further Details:      
 
Domain Number 2 Region: 368-424,451-470
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000994
Family Pseudo ankyrin repeat 0.024
Further Details:      
 
Domain Number 3 Region: 427-497
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000663
Family Ankyrin repeat 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A225X3G1
Sequence length 500
Comment (tr|A0A225X3G1|A0A225X3G1_9STRA) Uncharacterized protein {ECO:0000313|EMBL:OWZ24456.1} KW=Complete proteome; Reference proteome OX=4795 OS=Phytophthora megakarya. GN=PHMEG_000530 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MYEPKSLMNVSLALPVAVALPHIIEAVNECLMPVAIDSAVYNDLKRVVKTHGDSRAWTFK
AMDGAAANGRLDIMQWLHDNRTEGCSEDACLAAAKRGEVGIIKWLHEFYPEVCQSVEAMT
VAAVNGHAKVVRFLRTNVAMNDAVPALEHAAVNGRVEIVDALVPYYSGLAQGAFMVAAAH
GQVEVVKLLLSQGFTSVMYTNPSLREAAEGGHLELVDLLLEFCDDDALADALDAAVAVNR
SDILQLIVERRHPKDFGAALEQAALSDRCDMVRLLLENCPEEEERYLSRNSVFSADVDLS
TRWNTQRSINAATVAAATRGHLETTKLLSEKCSDSASATALNITVNSDNLEMAKLFVMKS
NPVGRVDALVTAVADEKLDMVKLLVENGDLRMIEQALVKISSAGNHIIAKKLLERCDPAA
CKRVFENAAANGVVALVQEMMDQMNERSAGDALRLAAMNGHAEVVKVLLVKSDAAGVTAA
FNVAAMQGRLAVVELLSERE
Download sequence
Identical sequences A0A225X3G1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]