SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A225YP19 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A225YP19
Domain Number 1 Region: 137-273
Classification Level Classification E-value
Superfamily ISP domain 5.89e-41
Family Rieske iron-sulfur protein (ISP) 0.00000286
Further Details:      
 
Domain Number 2 Region: 96-151
Classification Level Classification E-value
Superfamily ISP transmembrane anchor 0.0000000000000916
Family ISP transmembrane anchor 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A225YP19
Sequence length 279
Comment (tr|A0A225YP19|A0A225YP19_CRYNV) Cytochrome b-c1 complex subunit Rieske, mitochondrial {ECO:0000256|RuleBase:RU004494} KW=Complete proteome OX=1230068 OS=Cryptococcus neoformans var. grubii c45. GN=C356_03411 OC=Cryptococcus neoformans species complex.
Sequence
MAAHIGRINLLPSIRTLASGAPLARGISLAVPAAGDAHSHGHDGQAGPRPDIPAAWAFKA
GARGHIGRTNALPTPPGFQQRFLSTTRNVPAAASSSATDVPDFSAYRAKNPNTTRNVSYF
MVGALGALGASSVKSTAVDMLSNMAASADVLALAKIEVEMGSIPEGKNLIVKWRGKPVFI
RHRTPDEIDEANNIDIKTLRDPETDEQRTQRPEWLVMLGICTHLGCVPIGEAGDYGGWFC
PCHGSHYDISGRVRRGPAPINLEIPEYTFNDDEEKIVIG
Download sequence
Identical sequences A0A225YP19

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]