SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A226EII2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A226EII2
Domain Number 1 Region: 1-162
Classification Level Classification E-value
Superfamily MAL13P1.257-like 1.44e-39
Family MAL13P1.257-like 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A226EII2
Sequence length 166
Comment (tr|A0A226EII2|A0A226EII2_FOLCA) Uncharacterized protein {ECO:0000313|EMBL:OXA57028.1} KW=Complete proteome; Reference proteome OX=158441 OS=Folsomia candida (Springtail). GN=Fcan01_08469 OC=Entomobryomorpha; Isotomoidea; Isotomidae; Proisotominae; Folsomia.
Sequence
MVKLGLQISARLENVEKLEVCGEDFRYFVKTLCSNCGEGSGDRWQYVAVNEVMEGRSGSR
NAECHMKVKCKGCQREVSLFILEDSTKPYIHDEDKPEAFQTILIIEGRGMEVTDFDFRGG
WSVKALNSTTIFENVDLTDKEWADYDEKSGDSVAIYDLKSKIVKLK
Download sequence
Identical sequences A0A226EII2
XP_021950679.1.6718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]