SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A226ESK9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A226ESK9
Domain Number 1 Region: 224-425
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.91e-38
Family Ankyrin repeat 0.00035
Further Details:      
 
Domain Number 2 Region: 522-814
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 2.49e-36
Family Patatin 0.0032
Further Details:      
 
Domain Number 3 Region: 86-103,148-273
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000000000301
Family Pseudo ankyrin repeat 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A226ESK9
Sequence length 855
Comment (tr|A0A226ESK9|A0A226ESK9_FOLCA) Calcium-independent phospholipase A2-gamma {ECO:0000313|EMBL:OXA60593.1} KW=Complete proteome; Reference proteome OX=158441 OS=Folsomia candida (Springtail). GN=Fcan01_04991 OC=Entomobryomorpha; Isotomoidea; Isotomidae; Proisotominae; Folsomia.
Sequence
MANIQGFGEIIGNLSRSVINTAFNAAANSASRAMDGFTVQEITGAGNIDDVTHYPVLNRT
MPLLLYGPVPPGRFLGTRPAYHVILHATNSSRMFSMLRSDNRKEAEDTFVLYKESFPLLV
ECDPMICDTNKLDAMARKLRENPGCWTAPHLASSSGLLNCLKHEKMKVKLNEQEGTMLRT
PLQIAIDQGNIGVISTLLELGVDVTIADIKGNSVFHVAATKSLPAFQLLLDKLPIRHHEL
LNHINAEGFTPLHSACKNNNAEIVKTLLAAGANSNVSSQLQGFPIHVAVKAQSVLCLQEL
VAHNPSQLQMKDLQEGGSPLHWAAGPETLIPLLDLGCDPNTTDANGLTPLHNAVRRGCLK
STIYLLCHGAFPDMKGGEDDDTPLHVASRLCSKTLMQALIVFGCDVNLLNKRGDNSRHLV
CTSQRSDKDQVLYILSAIGAMRCSPSKASSCVDGCKFSGSFEGSQPPNFPTHGAVNLMHE
ALSALGNIQAGGSGHHNNNNKTDSAATSSFADSLDPINLGGRLLCLDGGGIRGMVLTQML
AVIQKELDLPVIEMFDWIAGTSTGGILALALSVGKTPLETQCIYMRLKDKVFVGERPYSA
TVMEEFLKQEFGCETTMGSIHRPKVMIMTALVDRRPVDLHIFRNYISPSVLMGETEVCEV
DHSSQCVWEAAKVTGAAPSYFRLDNDKFIDGGLISNNPTLDAMTEMQRFKTAMKKLGYFR
NGEKFPTTVVSLGTGIPPKTSSTASAIDITWPSGIFDTITKVPRLASLVNLLIDQATQSE
GQVVERARAWCSSIDVPFFRFSPQMTVDVGLDEKNDVTLINLLWETRCFMMSNKDTILKM
KHILVQQQQSRVPTR
Download sequence
Identical sequences A0A226ESK9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]