SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A226MEF0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A226MEF0
Domain Number 1 Region: 35-152
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 6.54e-40
Family Frizzled cysteine-rich domain 0.0000594
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A226MEF0
Sequence length 170
Comment (tr|A0A226MEF0|A0A226MEF0_CALSU) Uncharacterized protein {ECO:0000313|EMBL:OXB53610.1} KW=Complete proteome; Reference proteome OX=9009 OS=Callipepla squamata (Scaled quail). GN=ASZ78_011998 OC=Odontophoridae; Callipepla.
Sequence
MPPRFCALLLLASQCLASAAGLFPFGEADFSYKRSNCKPIPAPMLLCRGIEYQSMRLPNL
LGHETVQEVLEQASTWIPLVQKQCHPDTRKFLCSLFAPVCIDDLDEIIQPCHSLCEEVKE
SCAPVMSAFGFPWPDMLDCSRFPKDNDLCIPLASSDHILPVTREGKRRLP
Download sequence
Identical sequences A0A226MEF0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]