SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A226NCI3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A226NCI3
Domain Number 1 Region: 187-297
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000105
Family Spermadhesin, CUB domain 0.003
Further Details:      
 
Domain Number 2 Region: 304-340
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000038
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 3 Region: 11-98
Classification Level Classification E-value
Superfamily SEA domain 0.000000000327
Family SEA domain 0.021
Further Details:      
 
Domain Number 4 Region: 399-438
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000367
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 5 Region: 113-187
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000236
Family Spermadhesin, CUB domain 0.0081
Further Details:      
 
Domain Number 6 Region: 360-394
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000929
Family LDL receptor-like module 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A226NCI3
Sequence length 458
Comment (tr|A0A226NCI3|A0A226NCI3_CALSU) Uncharacterized protein {ECO:0000313|EMBL:OXB65212.1} KW=Complete proteome; Reference proteome OX=9009 OS=Callipepla squamata (Scaled quail). GN=ASZ78_014877 OC=Odontophoridae; Callipepla.
Sequence
MMLLSLLDSVQMNLVYTTSSFSKFYKQSTVTEVSNNNNGGLLVHFWIVFVVPQAKGQALC
EDCVAAILKDSIQTSIVNRTSVGTLQGLAVDMDSVVLSAGLRSDYWSTTGTVSLQIEADN
CITDSLTIYDSLMPIKHRILYQACEPADSLVSLVSTNNLMLVIFKAAHMKEQKGFRGYFE
VITQERCGKAIVTKEKTGYEGRITSPYYPSYYPPKCLCAWNLQTPHKNLGIALKFHNYTI
SEKNIKGCERGWWKINEHMYCGFYVDHQTVFHIASSAVNIELQCSSKVSEKPLLVEYGSY
NISQPCPPGYFKCSTGLCIQQMQRCDGVNNCFDESDELFCGLYSFTRDLDSETHSLVLRV
VPEWNCNSTFAIQDNLLVCNGVNDCENGEDEQNCTDSIPCSSHTFKCRNNLCIKKQNAKC
DGTVDCADGSDESGCSKSLLLFCTLNSFHFKALYFFLF
Download sequence
Identical sequences A0A226NCI3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]