SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A226NNN8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A226NNN8
Domain Number 1 Region: 157-188
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000133
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A226NNN8
Sequence length 227
Comment (tr|A0A226NNN8|A0A226NNN8_CALSU) Uncharacterized protein {ECO:0000313|EMBL:OXB68890.1} KW=Complete proteome; Reference proteome OX=9009 OS=Callipepla squamata (Scaled quail). GN=ASZ78_005327 OC=Odontophoridae; Callipepla.
Sequence
MNFHYNPQISFFKLLREQEISVTTRKLKKSSIPSAATPPPIAESPLSLKDFSVMETPASV
DQPSVLESSEPADHLVVENPLGSEDQFPIPRGNSADRSPVGEQLGFLVKMSVTESSKSWS
KMSLNESAAAVVKPAEKACEISEQPMVYEDPFEASVKYVEKHNILQIFQEITVKLLYEKP
DDPLQFMLLQVQSMINARQAKMEGVSEEHKDTEEFLGENLGAPSGFS
Download sequence
Identical sequences A0A226NNN8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]