SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A226PKS3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A226PKS3
Domain Number - Region: 54-90
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00968
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A226PKS3
Sequence length 99
Comment (tr|A0A226PKS3|A0A226PKS3_COLVI) Uncharacterized protein {ECO:0000313|EMBL:OXB80298.1} KW=Complete proteome; Reference proteome OX=9014 OS=Colinus virginianus (Northern bobwhite) (Tetrao virginianus). GN=H355_013696 OC=Odontophoridae; Colinus.
Sequence
MEAEQIMEGQPQVPENPHSEYGLTENVERIVENEKLNAEKTSKQKVDLQSLPTRAYLDQT
VVPILLQGLAVLAKERPPNPIEFLAAYLLKNKSQFEDRN
Download sequence
Identical sequences A0A226PKS3 G1NFR9
XP_003204026.1.16129 XP_021246416.1.32913 XP_021246417.1.32913 ENSMGAP00000011876 ENSMGAP00000011876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]